| Allergen-Scientific Name | Taxonomy Name | Genbank Common Name | Category |
|---|---|---|---|
| Ara h 3 | Arachis hypogaea | Peanut |
|
| IsoAllergen | Source of Allergen Name |
|---|---|
IsoAllergen
|
UNIPROT |
| DataSource | UniProt Acc | Motif |
Original Reference (gi number) |
Allergen Description |
|---|---|---|---|---|
| Q0GM57 | ADFS_0006 | 112380623 | Iso-Ara h3 | |
| Q8LKN1 | ADFS_0006 | 21314465 | ||
| B5TYU1 | ADFS_0006 | 199732457 | Arachin Arah3 isoform | |
| B5TYU1 | ADFS_0006 | 224036293 | Arachin Arah3 isoform | |
| E5G077 | ADFS_0006 | 312233065 | Ara h 3 allergen |
| Pubmed | 20541807 |
| Uniprot Acc. | Q8LKN1 |
| Title | Characterization of IgE-binding epitopes of peanut (Arachis hypogaea) PNA lectin allergen cross-reacting with other structurally related legume lectins. |
| Author | Rouge P, Culerrier R, Granier C, Rance F, Barre A. |
| Journal | Mol Immunol. 2010 Aug;47(14):2359-66. Epub 2010 Jun 12. |
| Method | SPOTassay |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | NIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVA | Epitope / Protein | 31 | 63 | ||
| 2 | LGVSDTKGA | Epitope / Protein | 106 | 114 | ||
| 3 | VDSVKTVPWNSVSGA | Epitope / Protein | 145 | 159 | ||
| 4 | IYDSSTKTL | Epitope / Protein | 166 | 174 | ||
| 5 | QVVDLKAKLPERVKF | Epitope / Protein | 190 | 204 | ||
| 6 | ASGSLGGRQIHLIRSWSFTSTLITT | Epitope / Protein | 208 | 232 |
No Sugar Informations.