Allergen-Scientific Name | Taxonomy Name | Genbank Common Name | Category |
---|---|---|---|
Bos d 5 | Bos taurus | Bovine |
![]() |
IsoAllergen | Source of Allergen Name |
---|---|
![]() IsoAllergen
|
UNIPROT |
DataSource | UniProt Acc | Motif |
Original Reference (gi number) |
Allergen Description |
---|---|---|---|---|
P02754 | ADFS_0105 | 162748 | Beta-lactoglobulin , Short=Beta-LG , Allergen=Bos d 5 | |
P02754 | ADFS_0105 | 669061 | Beta-lactoglobulin , Short=Beta-LG , Allergen=Bos d 5 | |
P02754 | ADFS_0105 | 162750 | Beta-lactoglobulin , Short=Beta-LG , Allergen=Bos d 5 | |
P02754 | ADFS_0105 | 125910 | Beta-lactoglobulin , Short=Beta-LG , Allergen=Bos d 5 | |
P02754 | ADFS_0105 | 520 | Beta-lactoglobulin , Short=Beta-LG , Allergen=Bos d 5 | |
P02754 | ADFS_0105 | 125910 | Beta-lactoglobulin , Short=Beta-LG , Allergen=Bos d 5 | |
P02754 | ADFS_0105 | 162750 | Beta-lactoglobulin , Short=Beta-LG , Allergen=Bos d 5 |
PDB | 1B0O | |
PDB | 1B8E | |
PDB | 1BEB | |
PDB | 1BSO | |
PDB | 1BSQ | |
PDB | 1BSY | |
PDB | 1CJ5 | |
PDB | 1DV9 | |
PDB | 1GX8 | |
PDB | 1GX9 | |
PDB | 1GXA | |
PDB | 1QG5 | |
PDB | 1UZ2 | |
PDB | 1YUP | |
PDB | 2AKQ | |
PDB | 2BLG | |
PDB | 2GJ5 | |
PDB | 2Q2M | |
PDB | 2Q2P | |
PDB | 2Q39 | |
PDB | 2R56 | |
PDB | 3BLG | |
PDB | 3KZA | |
PDB | 3NPO | |
PDB | 3NQ3 | |
PDB | 3NQ9 | |
PDB | 3PH5 | |
PDB | 3PH6 | |
PDB | 3UEU | |
PDB | 3UEV | |
PDB | 3UEW | |
PDB | 3UEX | |
PDB | 4DQ3 | |
PDB | 4DQ4 | |
PDB | 4GNY | |
PDB | 4IB6 | |
PDB | 4IB7 | |
PDB | 4IB8 | |
PDB | 4IB9 | |
PDB | 4IBA | |
PDB | 4KII | |
PDB | 4LZU | |
PDB | 4LZV | |
PDB | 4Y0P | |
PDB | 4Y0Q | |
PDB | 4Y0R | |
PDB | 5EEE | |
PDB | 5HTD | |
PDB | 5HTE | |
PDB | 5IO5 | |
PDB | 5IO7 | |
PDB | 5K06 | |
PDB | 5LKE | |
PDB | 5LKF | |
PDB | 5NUJ | |
PDB | 5NUK | |
PDB | 5NUM | |
PDB | 5NUN | |
PDB | 5Y5C | |
PDB | 6FXB | |
PDB | 6GE7 | |
PDB | 6GF9 | |
PDB | 6GFS | |
PDB | 6GHH |
Pubmed | 11729348 |
Uniprot Acc. | P02754 |
Title | IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy. |
Author | Jarvinen KM, Chatchatee P, Bardina L, Beyer K, Sampson HA. |
Journal | Int Arch Allergy Immunol. 2001 Oct;126(2):111-8. |
Method | SPOT-method |
No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
---|---|---|---|---|---|---|
1 | LIVTQTMKGLDIQKVA | Epitope / Protein | 17 | 32 | ||
2 | LLDASAPLRVYVEELKP | Epitope / Protein | 47 | 64 | ||
3 | KPTPEGDLEILLQK | Epitope / Protein | 63 | 76 | ||
4 | AQKKIIAEKTKI | Epitope / Protein | 83 | 94 | ||
5 | KTKIPAVFKIDA | Epitope / Protein | 91 | 102 | ||
6 | EVDDEALEKFDKALKALP | Epitope / Protein | 143 | 160 | ||
7 | KALPMHIRLSFN | Epitope / Protein | 157 | 168 |
Pubmed | 19054564 |
Uniprot Acc. | P02754 |
Title | Immune recognition of novel isoforms and domains of the mugwort pollen major allergen Art v 1. |
Author | Dedic A, Gadermaier G, Vogel L, Ebner C, Vieths S, Ferreira F, Egger M. |
Journal | Mol Immunol. 2009 Jan;46(3):416-21. Epub 2008 Dec 2. |
Method | peptidearray |
No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
---|---|---|---|---|---|---|
1 | LQKWENDECAQKKIIAEKTK | Epitope / Protein | 58 | 77 | associated to the reactive patients' group | |
2 | TKIPAVFKIDALNENKVLVL | Epitope / Protein | 76 | 95 | ||
3 | CLVRTPEVDDEALEKFDKAL | Epitope / Protein | 121 | 140 |
Pubmed | 19577281 |
Uniprot Acc. | P02754 |
Title | Development of a novel peptide microarray for large-scale epitope mapping of food allergens. |
Author | Lin J, Bardina L, Shreffler WG, Andreae DA, Ge Y, Wang J, Bruni FM, Fu Z, Han Y, Sampson HA. |
Journal | J Allergy Clin Immunol. 2009 Aug;124(2):315-22 322.e1-3. Epub 2009 Jul 3. |
Method | peptidemicroarray |
No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
---|---|---|---|---|---|---|
1 | GTWYSLAMAASDISLLDAQSAPL | Epitope / Protein | 33 | 55 | detected as 2 contiguous spots in peptide microarray | |
2 | ASDISLLDAQSAPLRVYVEE | Epitope / Protein | 42 | 61 | ||
3 | QSAPLRVYVEELKPTPEGDLEILLQKWENGECAQK | Epitope / Protein | 51 | 85 | detected as 6 contiguous spots in peptide microarray | |
4 | ECAQKKIIAEKTKIPAVFKIDALNEN | Epitope / Protein | 81 | 106 | detected as 3 contiguous spots in peptide microarray | |
5 | DYKKYLLFCMENSAEPEQSLACQCLV | Epitope / Protein | 114 | 139 | detected as 3 contiguous spots in peptide microarray | |
6 | SLACQCLVRTPEVDDEALEKFDKALKALPMHIRLS | Epitope / Protein | 132 | 166 | detected as 6 contiguous spots in peptide microarray | |
7 | LKALPMHIRLSFNPTQLEEQCHI | Epitope / Protein | 156 | 178 | detected as 2 contiguous spots in peptide microarray |
Pubmed | 22939793 |
Uniprot Acc. | P02754 |
Title | Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes in _xDCE2_-lactoglobulin by alanine scanning analysis. |
Author | Cong YJ, Li LF. |
Journal | J Dairy Sci. 2012 Nov;95(11):6307-12. doi: 10.3168/jds.2012-5543. Epub 2012 Aug 29. |
Method | SPOTs |
No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
---|---|---|---|---|---|---|
1 | LIVTQTMKGLDIQKV | Epitope / Protein | 17 | 31 | Amino acids shown in red are essential for IgE binding | |
2 | ILLQKWENGECAQKK | Epitope / Protein | 72 | 86 | ||
3 | TKIPAVFKIDALNEN | Epitope / Protein | 92 | 106 | ||
4 | FDKALKALPMHIRLS | Epitope / Protein | 152 | 166 |
No Sugar Informations.