| Allergen-Scientific Name | Taxonomy Name | Genbank Common Name | Category |
|---|---|---|---|
| Bos d 8 | Bos taurus | Bovine |
|
| IsoAllergen | Source of Allergen Name |
|---|---|
|
IsoAllergen
|
UNIPROT |
| DataSource | UniProt Acc | Motif |
Original Reference (gi number) |
Allergen Description |
|---|---|---|---|---|
| P02662 | 162650 | Alpha-S1-casein , Allergen=Bos d 8[Contains: RecName: Full=Antioxidant peptide] | ||
| P02662 | 159793197 | Alpha-S1-casein , Allergen=Bos d 8[Contains: RecName: Full=Antioxidant peptide] | ||
| P02662 | 159793201 | Alpha-S1-casein , Allergen=Bos d 8[Contains: RecName: Full=Antioxidant peptide] | ||
| P02662 | 159793217 | Alpha-S1-casein , Allergen=Bos d 8[Contains: RecName: Full=Antioxidant peptide] | ||
| P02662 | 30794348 | Alpha-S1-casein , Allergen=Bos d 8[Contains: RecName: Full=Antioxidant peptide] | ||
| P02662 | 162650 | Alpha-S1-casein , Allergen=Bos d 8[Contains: RecName: Full=Antioxidant peptide] | ||
| P02662 | 162794 | Alpha-S1-casein , Allergen=Bos d 8[Contains: RecName: Full=Antioxidant peptide] | ||
| P02662 | 162927 | Alpha-S1-casein , Allergen=Bos d 8[Contains: RecName: Full=Antioxidant peptide] |
No Structure Informations.
| Pubmed | 12897753 |
| Uniprot Acc. | P02662 |
| Title | Mutational analysis of major, sequential IgE-binding epitopes in alpha s1-casein, a major cow's milk allergen. |
| Author | Cocco RR, Jarvinen KM, Sampson HA, Beyer K. |
| Journal | J Allergy Clin Immunol. 2003 Aug;112(2):433-7. |
| Method | SPOT-method |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | NENLLRFFVAPFPE | Epitope / Protein | 17 | 25 | Critical amino acid are marked in red : NENLLRFFVAPFPE | |
| 2 | FFVAPFPEVFGKEK | Epitope / Protein | 23 | 36 | Critical amino acid are marked in red:YTDAPSFSDIPNPI | |
| 3 | ERYLGYLEQLLRLK | Epitope / Protein | 89 | 102 | Critical amino acid are marked in red:YPSGAWYYVPLGTQ | |
| 4 | LEIVPNSAEERL | Epitope / Protein | 109 | 120 | Critical amino acid are marked in red:FSDIPNPIGSENSE | |
| 5 | NQELAYFYPELFRQ | Epitope / Protein | 139 | 152 | Critical amino acid are marked in red:NQELAYFYPELFRQ | |
| 6 | YPSGAWYYVPLGTQ | Epitope / Protein | 159 | 172 | Critical amino acid are marked in red:LEIVPNSAEERL | |
| 7 | YTDAPSFSDIPNPI | Epitope / Protein | 173 | 186 | Critical amino acid are marked in red:ERYLGYLEQLLRLK | |
| 8 | FSDIPNPIGSENSE | Epitope / Protein | 179 | 192 | Critical amino acid are marked in red:FFVAPFPEVFGKEK |
| Pubmed | 8836334 |
| Uniprot Acc. | P02662 |
| Title | Allergenic epitopes of bovine alpha S1-casein recognized by human IgE and IgG. |
| Author | Spuergin P, Mueller H, Walter M, Schiltz E, Forster J. |
| Journal | Allergy. |
| Method | SPOTs |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | NLLRFFVAPFPE | Epitope / Protein | 34 | 45 | ||
| 2 | GYLEQL | Epitope / Protein | 108 | 113 | ||
| 3 | ELAYFYPELF | Epitope / Protein | 156 | 165 |
| Pubmed | 9600504 |
| Uniprot Acc. | P02662 |
| Title | Determinant analysis of IgE and IgG4 antibodies and T cells specific for bovine alpha(s)1-casein from the same patients allergic to cow's milk: existence of alpha(s)1-casein-specific B cells and T cells characteristic in cow's-milk allergy. |
| Author | Nakajima-Adachi H, Hachimura S, Ise W, Honma K, Nishiwaki S, Hirota M, Shimojo N, Katsuki T, Ametani A, Kohno Y, Kaminogawa S. |
| Journal | J Allergy Clin Immunol. |
| Method | Pin-ELISA |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | DIPNPIGSENSEKTTMPLW | Epitope / Protein | 196 | 214 |
| Pubmed | 11174208 |
| Uniprot Acc. | P02662 |
| Title | Identification of IgE- and IgG-binding epitopes on alpha(s1)-casein: differences in patients with persistent and transient cow's milk allergy. |
| Author | Chatchatee P, Jarvinen KM, Bardina L, Beyer K, Sampson HA. |
| Journal | J Allergy Clin Immunol. |
| Method | ELISA |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | NENLLRFFVAPFPEVFGKEK | Epitope / Protein | 32 | 51 | major | |
| 2 | ELSKDIGSES | Epitope / Protein | 54 | 63 | minor | |
| 3 | EEIVPNSVEQ | Epitope / Protein | 84 | 93 | minor | |
| 4 | KEDVPSERYLGYLEQLLRLK | Epitope / Protein | 98 | 117 | major | |
| 5 | LEIVPNSAEERL | Epitope / Protein | 124 | 135 | major | |
| 6 | MKEGIHAQQK | Epitope / Protein | 138 | 147 | minor | |
| 7 | NQELAYFYPELFRQFY | Epitope / Protein | 154 | 169 | major | |
| 8 | YPSGAWYYVPLGTQYT | Epitope / Protein | 174 | 189 | major | |
| 9 | YTDAPSFSDIPNPIGSENSEKT | Epitope / Protein | 188 | 209 | major |
| Pubmed | 15541041 |
| Uniprot Acc. | P02662 |
| Title | Evaluation of the allergenicity and antigenicity of bovine-milk alphas1-casein using extensively purified synthetic peptides. |
| Author | Elsayed S, Hill DJ, Do TV. |
| Journal | Scand J Immunol. |
| Method | SPOTs |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | RPKHPIKHQGLPQEVLNE | Epitope / Protein | 16 | 33 | ||
| 2 | LNENLLRFFVAPFPEVFGKE | Epitope / Protein | 31 | 50 | ||
| 3 | VFGKEKVNELSKDIGSESTE | Epitope / Protein | 46 | 65 | ||
| 4 | IGVNQELAYFYPELFRQFYQ | Epitope / Protein | 151 | 170 |
| Pubmed | 11678861 |
| Uniprot Acc. | P02662 |
| Title | Role of conformational and linear epitopes in the achievement of tolerance in cow's milk allergy. |
| Author | Vila L, Beyer K, Jarvinen KM, Chatchatee P, Bardina L, Sampson HA. |
| Journal | Clin Exp Allergy. 2001 Oct;31(10):1599-606. |
| Method | Bio/strepFEIA |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | EEIVPNSVEQ | Epitope / Protein | 84 | 93 | Reactivity with tolerant's patients:low | |
| 2 | DAPSFSDIPNPIGSENSE | Epitope / Protein | 190 | 207 | Reactivity with tolerant's patients:high |
| Pubmed | 12170271 |
| Uniprot Acc. | P02662 |
| Title | B-cell epitopes as a screening instrument for persistent cow's milk allergy. |
| Author | Jarvinen KM, Beyer K, Vila L, Chatchatee P, Busse PJ, Sampson HA. |
| Journal | J Allergy Clin Immunol. |
| Method |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | ELSKDIGSES | Epitope / Protein | 54 | 63 | Reactivity with tolerant's patients:low | |
| 2 | MKEGIHAQQK | Epitope / Protein | 138 | 147 | Reactivity with tolerant's patients:low |
| Pubmed | 12170271 |
| Uniprot Acc. | P02662 |
| Title | B-cell epitopes as a screening instrument for persistent cow's milk allergy. |
| Author | Jarvinen KM, Beyer K, Vila L, Chatchatee P, Busse PJ, Sampson HA. |
| Journal | J Allergy Clin Immunol. |
| Method |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | KDERFFSDKI | Epitope / Protein | 34 | 43 | Reactivity with tolerant's patients:low | |
| 2 | SPPEINTVQV | Epitope / Protein | 176 | 185 | Reactivity with tolerant's patients:low |
| Pubmed | 12897753 |
| Uniprot Acc. | P02662 |
| Title | Mutational analysis of major, sequential IgE-binding epitopes in alpha s1-casein, a major cow's milk allergen. |
| Author | Cocco RR, Jarvinen KM, Sampson HA, Beyer K. |
| Journal | J Allergy Clin Immunol. 2003 Aug;112(2):433-7. |
| Method |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | NENLLRFFVAPFPE | Epitope / Protein | 32 | 45 | critical amino acids are marked in red (38, 39, 43) | |
| 2 | FFVAPFPEVFGKEK | Epitope / Protein | 38 | 51 | critical amino acids are marked in red (38, 39, 43, 47) | |
| 3 | ERYLGYLEQLLRLK | Epitope / Protein | 104 | 117 | critical amino acids are marked in red (110, 113) | |
| 4 | LEIVPNSAEERL | Epitope / Protein | 124 | 135 | critical amino acids are marked in red (128, 129, 132) | |
| 5 | NQELAYFYPELFRQ | Epitope / Protein | 154 | 167 | critical amino acids are marked in red (160, 161) | |
| 6 | YPSGAWYYVPLGTQ | Epitope / Protein | 174 | 187 | critical amino acids are marked in red (181, 184) | |
| 7 | YTDAPSFSDIPNPI | Epitope / Protein | 188 | 201 | critical amino acids are marked in red (197, 198, 201) | |
| 8 | FSDIPNPIGSENSE | Epitope / Protein | 194 | 207 | critical amino acids are marked in red (197, 198, 201) |
| Pubmed | 19054564 |
| Uniprot Acc. | P02662 |
| Title | Immune recognition of novel isoforms and domains of the mugwort pollen major allergen Art v 1. |
| Author | Dedic A, Gadermaier G, Vogel L, Ebner C, Vieths S, Ferreira F, Egger M. |
| Journal | Mol Immunol. 2009 Jan;46(3):416-21. Epub 2008 Dec 2. |
| Method | peptidearray |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | LNENLLRFFVAPFPEVFGKE | Epitope / Protein | 16 | 35 | ||
| 2 | FPEVFGKEKVNELSKDIGSESTE | Epitope / Protein | 28 | 50 | associated to the reactive patients' group | |
| 3 | PNSVEQKHIQKEDVPSERYL | Epitope / Protein | 73 | 92 |
| Pubmed | 19577281 |
| Uniprot Acc. | P02662 |
| Title | Development of a novel peptide microarray for large-scale epitope mapping of food allergens. |
| Author | Lin J, Bardina L, Shreffler WG, Andreae DA, Ge Y, Wang J, Bruni FM, Fu Z, Han Y, Sampson HA. |
| Journal | J Allergy Clin Immunol. 2009 Aug;124(2):315-22 322.e1-3. Epub 2009 Jul 3. |
| Method | peptidemicroarray |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | KHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKVNELSKDIGSEST | Epitope / Protein | 18 | 64 | detected as 10 contiguous spots in peptide microarray | |
| 2 | KVNELSKDIGSESTEDQAME | Epitope / Protein | 51 | 70 | ||
| 3 | KDIGSESTEDQAMEDIKQMEAESISS | Epitope / Protein | 57 | 82 | detected as 3 contiguous spots in peptide microarray | |
| 4 | MEAESISSSEEIVPNSVEQKHIQKED | Epitope / Protein | 75 | 100 | detected as 3 contiguous spots in peptide microarray | |
| 5 | VPNSVEQKHIQKEDVPSERYLGYLEQLLRLKKYKV | Epitope / Protein | 87 | 121 | detected as 6 contiguous spots in peptide microarray | |
| 6 | KKYKVPQLEIVPNSAEERLHSMKEGI | Epitope / Protein | 117 | 142 | detected as 3 contiguous spots in peptide microarray | |
| 7 | NSAEERLHSMKEGIHAQQKEPMIGVNQEL | Epitope / Protein | 129 | 157 | detected as 4 contiguous spots in peptide microarray | |
| 8 | AQQKEPMIGVNQELAYFYPELFRQFYQLD | Epitope / Protein | 144 | 172 | detected as 4 contiguous spots in peptide microarray | |
| 9 | YFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNPIGSENSEKTTMPLW | Epitope / Protein | 159 | 214 | detected as 13 contiguous spots in peptide microarray |
| Pubmed | 24035023 |
| Uniprot Acc. | P02662 |
| Title | Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes on ??s1-casein by alanine scanning analysis. |
| Author | Cong Y, Yi H, Qing Y, Li L. |
| Journal | J Dairy Sci. 2013 Nov;96(11):6870-6. doi: 10.3168/jds.2013-6880. Epub 2013 Sep 12. |
| Method | Peptide array |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | IKHQGLPQEVLNENL | Epitope / Protein | 21 | 35 | ||
| 2 | LPQEVLNENLLRFFV | Epitope / Protein | 26 | 40 | Amino acids shown in red are essential for IgE binding | |
| 3 | VEQKHIQKEDVPSER | Epitope / Protein | 91 | 105 | ||
| 4 | GIHAQQKEPMIGVNQ | Epitope / Protein | 140 | 155 | ||
| 5 | TQYTDAPSFSDIPNP | Epitope / Protein | 186 | 200 |
No Sugar Informations.