| Allergen-Scientific Name | Taxonomy Name | Genbank Common Name | Category |
|---|---|---|---|
| Bos d 8 (alpha-s2) | Bos taurus | Bovine |
|
| IsoAllergen | Source of Allergen Name |
|---|---|
IsoAllergen
|
ADFS |
| DataSource | UniProt Acc | Motif |
Original Reference (gi number) |
Allergen Description |
|---|---|---|---|---|
| P02663 | ADFS_0082 | 162929 | Alpha-S2-casein [Contains: RecName: Full=Casocidin-1] , Casocidin-I |
| Pubmed | 12373003 |
| Uniprot Acc. | P02663 |
| Title | Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients. |
| Author | Busse PJ, Jarvinen KM, Vila L, Beyer K, Sampson HA. |
| Journal | Int Arch Allergy Immunol. 2002 Sep;129(1):93-6. |
| Method | SPOT-method |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | NEINQFYQKFPQYLQYLY | Epitope / Protein | 83 | 100 | minor IgE-binding epitope | |
| 2 | STEVFTKKTKLTEEEK | Epitope / Protein | 143 | 158 | major IgE-binding epitope located in the carboxy terminal portion of the protein | |
| 3 | EKNRLNFLKKISQRYQ | Epitope / Protein | 157 | 172 | major IgE-binding epitope located in the carboxy terminal portion of the protein | |
| 4 | KKISQRYQKFALPQYLKTVYQHQK | Epitope / Protein | 165 | 188 | major IgE-binding epitope located in the carboxy terminal portion of the protein | |
| 5 | SKENLCSTFCKEVV | Epitope / Protein | 31 | 44 | major IgE-binding epitope located in the carboxy terminal portion of the protein | |
| 6 | VVRNANEEEYSIGS | Epitope / Protein | 43 | 56 | minor IgE-binding epitope | |
| 7 | PQYLQYLYQGPIVL | Epitope / Protein | 93 | 106 | minor IgE-binding epitope | |
| 8 | VLNPWDQVKR | Epitope / Protein | 105 | 114 | minor IgE-binding epitope | |
| 9 | VPITPTLNREQLS | Epitope / Protein | 117 | 128 | minor IgE-binding epitope | |
| 10 | KPWIQPKTKV | Epitope / Protein | 191 | 200 | minor IgE-binding epitope |
| Pubmed | 12373003 |
| Uniprot Acc. | P02663 |
| Title | Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients. |
| Author | Busse PJ, Jarvinen KM, Vila L, Beyer K, Sampson HA. |
| Journal | Int Arch Allergy Immunol. 2002 Sep;129(1):93-6. |
| Method | SPOTs |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | NEINQFYQKFPQYLQYLY | Epitope / Protein | 98 | 115 | major | |
| 2 | STEVFTKKTKLTEEEK | Epitope / Protein | 158 | 173 | major | |
| 3 | EKNRLNFLKKISQRYQ | Epitope / Protein | 172 | 187 | major | |
| 4 | KKISQRYQKFALPQYLKTVYQHQK | Epitope / Protein | 180 | 203 | major | |
| 5 | SKENLCSTFCKEVV | Epitope / Protein | 46 | 59 | minor | |
| 6 | VVRNANEEEYSIGS | Epitope / Protein | 58 | 71 | minor | |
| 7 | PQYLQYLYQGPIVL | Epitope / Protein | 108 | 121 | minor | |
| 8 | VLNPWDQVKR | Epitope / Protein | 120 | 129 | minor | |
| 9 | VPITPTLNREQLS | Epitope / Protein | 132 | 143 | minor | |
| 10 | KPWIQPKTKV | Epitope / Protein | 206 | 215 | minor |
| Pubmed | 12170271 |
| Uniprot Acc. | P02663 |
| Title | B-cell epitopes as a screening instrument for persistent cow's milk allergy. |
| Author | Jarvinen KM, Beyer K, Vila L, Chatchatee P, Busse PJ, Sampson HA. |
| Journal | J Allergy Clin Immunol. |
| Method |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | YQKFALPQYL | Epitope / Protein | 186 | 195 | Reactivity with tolerant's patients:low |
| Pubmed | 19054564 |
| Uniprot Acc. | P02663 |
| Title | Immune recognition of novel isoforms and domains of the mugwort pollen major allergen Art v 1. |
| Author | Dedic A, Gadermaier G, Vogel L, Ebner C, Vieths S, Ferreira F, Egger M. |
| Journal | Mol Immunol. 2009 Jan;46(3):416-21. Epub 2008 Dec 2. |
| Method | peptidearray |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | KNTMEHVSSSEESIISQETY | Epitope / Protein | 1 | 20 | associated to the reactive patients' group | |
| 2 | SIISQETYKQEKNMAINPSK | Epitope / Protein | 13 | 32 | associated to the reactive patients' group | |
| 3 | EEVKITVDDKHYQKAL | Epitope / Protein | 67 | 82 | associated to the reactive patients' group | |
| 4 | LNPWDQVKRNAVPITPTLNRE | Epitope / Protein | 106 | 125 | ||
| 5 | TLNREQLSTSEENSKKTVDM | Epitope / Protein | 122 | 141 | ||
| 6 | EKNRLNFLKKISQRYQKFALPQYLKT | Epitope / Protein | 157 | 182 | ||
| 7 | KTVYQHQKAMKPWIQPKTKVIPYVRYL | Epitope / Protein | 181 | 207 | associated to the reactive patients' group |
| Pubmed | 19577281 |
| Uniprot Acc. | P02663 |
| Title | Development of a novel peptide microarray for large-scale epitope mapping of food allergens. |
| Author | Lin J, Bardina L, Shreffler WG, Andreae DA, Ge Y, Wang J, Bruni FM, Fu Z, Han Y, Sampson HA. |
| Journal | J Allergy Clin Immunol. 2009 Aug;124(2):315-22 322.e1-3. Epub 2009 Jul 3. |
| Method | peptidemicroarray |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | YKQEKNMAINPSKENLCSTFCKEVVR | Epitope / Protein | 35 | 60 | detected as 3 contiguous spots in peptide microarray | |
| 2 | KENLCSTFCKEVVRNANEEEYSIGSS | Epitope / Protein | 47 | 72 | detected as 3 contiguous spots in peptide microarray | |
| 3 | VRNANEEEYSIGSSSEESAE | Epitope / Protein | 59 | 78 | ||
| 4 | SSSEESAEVATEEVKITVDDKHYQKALNEINQ | Epitope / Protein | 71 | 102 | detected as 5 contiguous spots in peptide microarray | |
| 5 | DDKHYQKALNEINQFYQKFPQYLQYL | Epitope / Protein | 89 | 114 | detected as 3 contiguous spots in peptide microarray | |
| 6 | NQFYQKFPQYLQYLYQGPIVLNPWDQVKRNAVPITPTLNRE | Epitope / Protein | 101 | 141 | detected as 8 contiguous spots in peptide microarray | |
| 7 | KRNAVPITPTLNREQLSTSE | Epitope / Protein | 128 | 147 | ||
| 8 | VFTKKTKLTEEEKNRLNFLK | Epitope / Protein | 161 | 180 | ||
| 9 | EEEKNRLNFLKKISQRYQKF | Epitope / Protein | 170 | 189 | ||
| 10 | YLKTVYQHQKAMKPWIQPKT | Epitope / Protein | 191 | 213 | ||
| 11 | KAMKPWIQPKTKVIPYVRYL | Epitope / Protein | 203 | 222 |
No Sugar Informations.