Search Result : Detailed Informations

Allergen-Scientific Name Taxonomy Name Genbank Common Name Category
Der p 7.0101 Dermatophagoides pteronyssinus European house dust mite

<Sequences>

DataSource UniProt Acc Motif

Original Reference

(gi number)

 Allergen Description
P49273 ADFS_0040 1045602 Mite allergen Der p 7 , Allergen Der p VII , Allergen=Der p 7

Structural Information

PDB 3H4Z

Domain Information

InterPro IPR020234
InterPro IPR038602
Pfam PF16984

<Epitope Information (1)>

Pubmed 34220841
Uniprot Acc. P49273
Title IgE Epitopes of the House Dust Mite Allergen Der p 7 Are Mainly Discontinuous and Conformational
Author Curin M, Huang HJ, Garmatiuk T, Gutfreund S, Resch-Marat Y, Chen KW, Fauland K, Keller W, Zieglmayer P, Zieglmayer R, Lemell P, Horak F, Hemmer W, Focke-Tejkl M, Flicker S, Vrtala S, Valenta R.
Journal Front Immunol. 2021 Jun 15;12:687294.
Method immunoblot/inhibition ELISA
No. Epitope Sequences Blast Search Start End Description Type
1 DPIHYDKITEEINKAVDEAVAAIEKSETFD Epitope / Protein 18 47 Bactericidal permeability-increasing like protein
2 VAAIEKSETFDPMKVPDHSDKFERHIGIIDL Epitope / Protein 37 67 Bactericidal permeability-increasing like protein
3 LKGELDMRNIQVRGLKQMKRVGDANVKSEDG Epitope / Protein 67 97 Bactericidal permeability-increasing like protein
4 VHDDVVSMEYDLAYKLGDLHPNTHVISDIQDFVVEL Epitope / Protein 107 142 Bactericidal permeability-increasing like protein
5 VELSLEVSEEGNMTLTSFEVRQFANV Epitope / Protein 140 165 Bactericidal permeability-increasing like protein
6 VNHIGGLSILDPIFAVLSDVLTAIFQDT Epitope / Protein 166 193 Bactericidal permeability-increasing like protein
7 TAIFQDTVRAEMTKVLAPAFKKELERNNQ Epitope / Protein 187 215 Bactericidal permeability-increasing like protein
8 Epitope / Protein - - Bactericidal permeability-increasing like protein
9 Epitope / Protein - - Bactericidal permeability-increasing like protein

<Sugar Information>

Uniprot Acc Start End Description
P49273 151 151 N-linked (GlcNAc...) asparagine. {ECO:0000255}.