| DataSource | UniProt Acc | Motif |
Original Reference (gi number) |
Allergen Description |
|---|---|---|---|---|
| 9967357 | ||||
| O22120 | ADFS_0006 | 9967357 | Alpha subunit of beta conglycinin |
No Structure Informations.
| Pubmed | 23454299 |
| Uniprot Acc. | O22120 |
| Title | Prediction and characterization of the linear IgE epitopes for the major soybean allergen _xDCE2_-conglycinin using immunoinformatics tools. |
| Author | Sun X, Shan X, Yan Z, Zhang Y, Guan L. |
| Journal | Food Chem Toxicol. 2013 Jun;56:254-60. doi: 10.1016/j.fct.2013.02.014. Epub 2013 Feb 26. |
| Method | Dot-blot inhibition |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | ECEEGEIPRPRPRPQHPEREPQQPGEKEE | Epitope / Protein | 5 | 38 | ||
| 2 | HEQREEQEWPRKEEKRGEKGSEEEDE | Epitope / Protein | 55 | 80 | ||
| 3 | QFPFPRPPHQKEERKQEEDEDEEQQR | Epitope / Protein | 90 | 115 | ||
| 4 | DEEQQRESEESEDSELRRHKNKNPFL | Epitope / Protein | 110 | 135 | ||
| 5 | NKNPFLFGSNRFETLFKNQYGRIRVLQRF | Epitope / Protein | 130 | 158 | ||
| 6 | TAILSLVNNDDRDSYRLQSGDALRVPSGT | Epitope / Protein | 201 | 229 | ||
| 7 | YYVVNPDNNENLRLITLAIPVNKPGRFES | Epitope / Protein | 231 | 259 | ||
| 8 | EQIRALSKRAKSSSRKTISSEDKPFN | Epitope / Protein | 320 | 345 | ||
| 9 | SEDKPFNLRSRDPIYSNKLGKFFEITPEKN | Epitope / Protein | 339 | 368 | ||
| 10 | DPIYSNKLGKFFEITPEKNPQLRDLD | Epitope / Protein | 350 | 375 | ||
| 11 | QRESYFVDAQPKKKEEGNKGRKGPLSSILR | Epitope / Protein | 511 | 540 |
No Sugar Informations.
related allergens