| Allergen-Scientific Name | Taxonomy Name | Genbank Common Name | Category |
|---|---|---|---|
| Hev b 13 | Hevea brasiliensis | Para rubber tree |
|
| IsoAllergen | Source of Allergen Name |
|---|---|
IsoAllergen
|
UNIPROT |
| DataSource | UniProt Acc | Motif |
Original Reference (gi number) |
Allergen Description |
|---|---|---|---|---|
| Q7Y1X1 | 51315784 |
No Structure Informations.
| Pubmed | 19945164 |
| Uniprot Acc. | Q7Y1X1 |
| Title | Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate moiety. |
| Author | Rouge P, Culerrier R, Campistron M, Granier C, Bienvenu F, Bienvenu J, Didier A, Barre A. |
| Journal | Mol Immunol. 2010 Jan;47(4):871-7. Epub 2009 Nov 27. |
| Method | SPOTs |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | AFYPLNPPYGETFFHRSTGRYSDGRLIIDFIAESFNLPYLSPYLSSLGSNFKHG | Epitope / Protein | 51 | 104 | exposed/accessible amino acids are marked in red | |
| 2 | PTTIIPAHGGFSPFYLDVQYSQFRQFIPRSQFIRETGGI | Epitope / Protein | 117 | 155 | exposed/accessible amino acids are marked in red | |
| 3 | SANVKKIYDLGARTFWIHNTGPIGCLSFILTYFPWAEKD | Epitope / Protein | 204 | 242 | exposed/accessible amino acids are marked in red | |
| 4 | QHFNHKLKEIVAQLRKDLPLATFVHVDIYSVKYSLF | Epitope / Protein | 255 | 290 | exposed/accessible amino acids are marked in red | |
| 5 | FPLITCCGYGGKYNFSVTAPC | Epitope / Protein | 300 | 318 | exposed/accessible amino acids are marked in red | |
| 6 | PVPLNMACHKTESLRTLASV | Epitope / Protein | 372 | 391 | exposed/accessible amino acids are marked in red |