| Allergen-Scientific Name | Taxonomy Name | Genbank Common Name | Category |
|---|---|---|---|
| Hol l 1.0102 | Holcus lanatus | Yorkshire-fog |
|
| DataSource | UniProt Acc | Motif |
Original Reference (gi number) |
Allergen Description |
|---|---|---|---|---|
| P43216 | ADFS_0011 | 1167836 | Major pollen allergen Hol l 1 , Allergen Hol l 1.0101/1.0102 , Allergen Hol l I , Allergen=Hol l 1 | |
| P43216 | ADFS_0011 | 1167836 | Major pollen allergen Hol l 1 , Allergen Hol l 1.0101/1.0102 , Allergen Hol l I , Allergen=Hol l 1 |
No Structure Informations.
| Pubmed | 9215246 |
| Uniprot Acc. | P43216 |
| Title | Mapping of IgE-binding epitopes on the recombinant major group I allergen of velvet grass pollen, rHol l 1. |
| Author | Schramm G, Bufe A, Petersen A, Haas H, Schlaak M, Becker WM. |
| Journal | J Allergy Clin Immunol. 1997 Jun;99(6 Pt 1):781-7. |
| Method | immunoblot |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | IAKVPPGPNITATYGDEWLDAKSTWYG | Epitope / Protein | 26 | 52 | C-terminus contains at least one discontinuous epitope | |
| 2 | AKSTWYGKPTGAGPKDNGGACGYKDVD | Epitope / Protein | 46 | 72 | C-terminus contains at least one discontinuous epitope | |
| 3 | GYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIK | Epitope / Protein | 67 | 101 | C-terminus contains at least one discontinuous epitope | |
| 4 | PIFKDGRGCGSCFEIK | Epitope / Protein | 86 | 101 | C-terminus contains at least one discontinuous epitope | |
| 5 | SGEPVTVHITDDNEEPIAPYHF | Epitope / Protein | 109 | 130 | C-terminus contains at least one discontinuous epitope |
| Uniprot Acc | Start | End | Description |
|---|---|---|---|
| P43216 | 34 | 34 | N-linked (GlcNAc...) asparagine. {ECO:0000255}. |
related allergens