| Allergen-Scientific Name | Taxonomy Name | Genbank Common Name | Category |
|---|---|---|---|
| Len c 1.0101 | Lens culinaris | Lentil |
|
| DataSource | UniProt Acc | Motif |
Original Reference (gi number) |
Allergen Description |
|---|---|---|---|---|
| Q84UI1 | ADFS_0006 | 29539109 | ||
| Q84UI1 | ADFS_0006 | 29539109 |
| HSSP | 1IPJ |
| Pubmed | 20816193 |
| Uniprot Acc. | Q84UI1 |
| Title | Identification of IgE sequential epitopes of lentil (Len c 1) by means of peptide microarray immunoassay. |
| Author | Vereda A, Andreae DA, Lin J, Shreffler WG, Ibanez MD, Cuesta-Herranz J, Bardina L, Sampson HA. |
| Journal | J Allergy Clin Immunol. 2010 Sep;126(3):596-601.e1. |
| Method | peptide microarray |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | EEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAIN | Epitope / Protein | 313 | 348 | ||
| 2 | PAGHPVAINASSDLNLIGFGINAKNNQ | Epitope / Protein | 340 | 366 | ||
| 3 | LIGFGINAKNNQRNFLAGEEDNVIS | Epitope / Protein | 355 | 379 | ||
| 4 | EEDNVISQIQRPVKELAFPGSSREVDR | Epitope / Protein | 373 | 399 |
No Sugar Informations.