| Allergen-Scientific Name | Taxonomy Name | Genbank Common Name | Category |
|---|---|---|---|
| Lit v 13 | Penaeus vannamei | Whiteleg shrimp |
|
| IsoAllergen | Source of Allergen Name |
|---|---|
IsoAllergen
|
NCBI description |
| DataSource | UniProt Acc | Motif |
Original Reference (gi number) |
Allergen Description |
|---|---|---|---|---|
| E2IH93 | 301153757 | Fatty acid-binding protein | ||
| E2IH93 | fatty acid-binding protein |
No Structure Informations.
| Pubmed | 34695231 |
| Uniprot Acc. | E2IH93 |
| Title | Structural and allergenic properties of the fatty acid binding protein from shrimp Litopenaeus vannamei |
| Author | Múnera M, Martínez D, Wortmann J, Zakzuk J, Keller W, Caraballo L, Puerta L. |
| Journal | Allergy. 2022 May;77(5):1534-1544. |
| Method | Peptide array/ELISA |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | VEITKDGDTYTMKTTTTFKTTEIKFKLGEEFEETTADGRVVKSTIT | Epitope / Protein | 40 | 85 | Fatty Acid Binding Protein | |
| 2 | ELLREFTDDKMLMECKVDDVVCKRVYSRLE | Epitope / Protein | 107 | 136 | Fatty Acid Binding Protein |
No Sugar Informations.