| Allergen-Scientific Name | Taxonomy Name | Genbank Common Name | Category |
|---|---|---|---|
| Par j 2.0101 | Parietaria judaica | Pellitory-of-the-wall |
|
| DataSource | UniProt Acc | Motif |
Original Reference (gi number) |
Allergen Description |
|---|---|---|---|---|
| P55958 | ADFS_0066 | 2497750 | Probable non-specific lipid-transfer protein 2 , Short=LTP 2 , Allergen Par j II , Major pollen allergen Par j 2.0101 , Protein P2 , Allergen=Par j 2.0101 | |
| P55958 | ADFS_0066 | 2497750 | Probable non-specific lipid-transfer protein 2 , Short=LTP 2 , Allergen Par j II , Major pollen allergen Par j 2.0101 , Protein P2 , Allergen=Par j 2.0101 |
No Structure Informations.
| Pubmed | 12680870 |
| Uniprot Acc. | P55958 |
| Title | Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes. |
| Author | Asturias JA, Gomez-Bayon N, Eseverri JL, Martinez A. |
| Journal | Clin Exp Allergy. 2003 Apr;33(4):518-24. |
| Method | SPOT-method |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | CLHFVK | Epitope / Protein | 14 | 19 | ||
| 2 | VKGEEKEPSK | Epitope / Protein | 18 | 27 | ||
| 3 | CSGTKKLSEE | Epitope / Protein | 30 | 39 | ||
| 4 | EEVKTTEQ | Epitope / Protein | 38 | 45 | ||
| 5 | KREACKCIVR | Epitope / Protein | 46 | 55 | ||
| 6 | CIVRATKGI | Epitope / Protein | 52 | 60 | ||
| 7 | KKCDI-KTT | Epitope / Protein | 73 | 81 | ||
| 8 | SKIQSTIF | Epitope / Protein | 92 | 99 |
| Pubmed | 12680870 |
| Uniprot Acc. | P55958 |
| Title | Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes. |
| Author | Asturias JA, Gomez-Bayon N, Eseverri JL, Martinez A. |
| Journal | Clin Exp Allergy. 2003 Apr;33(4):518-24. |
| Method |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | CLHFVK | Epitope / Protein | 45 | 50 | ||
| 2 | VKGEEKEPSK | Epitope / Protein | 49 | 58 | ||
| 3 | CSGTKKLSEE | Epitope / Protein | 61 | 70 | ||
| 4 | EEVKTTEQ | Epitope / Protein | 69 | 76 | ||
| 5 | KREACKCIVR | Epitope / Protein | 77 | 86 | ||
| 6 | CIVRATKGI | Epitope / Protein | 83 | 91 | ||
| 7 | KKCDIKTT | Epitope / Protein | 104 | 111 | ||
| 8 | SKIQSTIF | Epitope / Protein | 122 | 129 |
| Pubmed | 25284812 |
| Uniprot Acc. | P55958 |
| Title | Multiple IgE recognition on the major allergen of the Parietaria pollen Par j 2. |
| Author | Longo V,Costa MA,Cibella F,Cuttitta G,La Grutta S,Colombo P |
| Journal | Mol Immunol.2015 Feb;63(2):412-9. doi: 10.1016/j.molimm.2014.09.012. Epub 2014 Oct 3. |
| Method | Immuno Blot |
| No. | Epitope Sequences | Blast Search | Start | End | Description | Type |
|---|---|---|---|---|---|---|
| 1 | EEACGKVVQDIMPCLHFVKGEEKEPSKECC | Epitope / Protein | 32 | 61 | ||
| 2 | EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIV | Epitope / Protein | 32 | 85 | ||
| 3 | SEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCD | Epitope / Protein | 68 | 107 | ||
| 4 | EACKCIVRATKGISGIKNELVAEVPKKCD | Epitope / Protein | 79 | 107 | ||
| 5 | ISGIKNELVAEVPKKCD | Epitope / Protein | 91 | 107 | ||
| 6 | ISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY | Epitope / Protein | 91 | 133 |
No Sugar Informations.